Protein Info for Echvi_1800 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03570: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family
  • amino acids 5 to 207 (203 residues), 184.7 bits, E=7.5e-59
• PF17836: PglD_N
  • amino acids 5 to 82 (78 residues), 30 bits, E=9.9e-11
• PF00132: Hexapep
  • amino acids 141 to 174 (34 residues), 33.5 bits, 3.5e-12
  • amino acids 159 to 193 (35 residues), 36.8 bits, 3.2e-13
• PF14602: Hexapep_2
  • amino acids 160 to 192 (33 residues), 29.2 bits, 9.4e-11

Best Hits

KEGG orthology group: None (inferred from 59% identity to mtt:Ftrac_3589)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

• L-cysteine biosynthesis I (2/2 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• D-cycloserine biosynthesis (1/6 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

See L0FW06 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Echvi_1800 sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKPVIILGAKGIAQPALEIFNSNEVTVYGFLDEDESLHGTEINVVPVLGNPEDDGYLKL
IGKKSEAFVAVDDNQYRQFLVKLLNDRRKTQPINAIHKTAYISTDAAIGHGNFINARVTI
GSGAEIGSHGIFHTGAIIDHGAKLEDFVQVGAGAVINSGVTIGKGAFIGSGVTVVSGVKI
GENARIGAGSVVVGDVEEETTVFGNPAAPIK