Protein Info for Echvi_1785 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: ribosomal protein L34, bacterial type
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to RL34_CHLTE: 50S ribosomal protein L34 (rpmH) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
KEGG orthology group: K02914, large subunit ribosomal protein L34 (inferred from 78% identity to hhy:Halhy_4029)MetaCyc: 64% identical to 50S ribosomal subunit protein L34 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L34p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FVZ9 at UniProt or InterPro
Protein Sequence (52 amino acids)
>Echvi_1785 ribosomal protein L34, bacterial type (Echinicola vietnamensis KMM 6221, DSM 17526) MKRTFQPSRRKRRNKHGFRERMASPNGRRVIRARRSKGRHKLSVSSEKTLKK