Protein Info for Echvi_1778 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 160 to 182 (23 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 420 to 437 (18 residues), see Phobius details PF03412: Peptidase_C39" amino acids 3 to 135 (133 residues), 124.6 bits, see alignment E=3.7e-40 PF00664: ABC_membrane" amino acids 170 to 431 (262 residues), 171.4 bits, see alignment E=5e-54 PF00005: ABC_tran" amino acids 493 to 639 (147 residues), 95.5 bits, see alignment E=6.7e-31

Best Hits

KEGG orthology group: None (inferred from 62% identity to zpr:ZPR_4399)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYE3 at UniProt or InterPro

Protein Sequence (717 amino acids)

>Echvi_1778 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKSIKQRDITDCGAACLASIASNYKLKIPISKIRQLASTDQKGTNVLGLIEAAGKLGFS
TKGVRGSFESLFQVPKPAIVHVVLNKTLHHYMVIYKVTKRYVKVMDPAEGRMKKLSHDEF
KDIWTGVMVLLMPNEEFKAMNETVSVAKRFWYLISPHKSVMLQAVFGAGIYTVLGLSTSI
YVQKIIDNVFISRNTNLLNLMSVVMILLLLFQIFIGVYKSIFVIKTGQKIDARLILGYYK
HLLSLPQRFFDTMRVGEIISRINDAVKIRAFINDVSISIVVNVFIVFFSFALMFTFYWKL
ALIMLMIVPLYLVVYVVTNHLNRRVERRLMENTAELESQLVESIHSVRTIKQFGAEDYAN
IKTEGKFINMLGSIYRSGLNNVFSSNSSEFISRLFTILLLWIGAGYVLENEITPGELLSF
YALIGYLTGPLVGIIGMNKTMQNAVIAADRLFEIMDLEVEEKKEKFEIKREDIGDIAFQQ
VVFRYGSRAKVFDGLNLTFPKGKVTGVVGESGSGKSTLAALLQHFYSLEAGQIKIGIHDI
SYIEHSCLRRIVGVVPQQVDLFAGNLIDNIAFGDHQPNIQKIVGICHELGMMDFIEGLPN
GFATFLGEHGASLSGGQRQRVAIARALYRDPEIIVMDEANASLDPKSEEYVQRVIRTLVK
KGKTVIFITHRLSAVRDFDRILVLEKGELVEQGGHHQLFAQEGRYYQMVQKQAFVLG