Protein Info for Echvi_1771 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 17 to 373 (357 residues), 196.4 bits, E=2.1e-61
• PF00890: FAD_binding_2
  • amino acids 17 to 57 (41 residues), 22.2 bits, 1.5e-08
• PF16901: DAO_C
  • amino acids 417 to 500 (84 residues), 79.2 bits, E=5.1e-26

Best Hits

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 54% identity to psn:Pedsa_2891)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• glycerol degradation I (2/3 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• nitrate reduction IX (dissimilatory) (1/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See L0FZ81 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Echvi_1771 Glycerol-3-phosphate dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNRAHNLRPLAKNQLWDIVIIGGGASGLGVALDALSRGLSVALFERADFAKGTSSRSTKL
VHGGVRYLAQGDILLVWEALRERGRILKNAPHLAHAQPFIIPIYSHATKYYYTVGLKFYD
WMSGWLSLGDSSFISKKETIKRLPEIKTEGLLGGVVYHDGAFDDARLAIAVAQTCDDMGG
CILNYMKVTSLTKDGAGIITGVKVRDAIHKKSYDVKAKMVVNATGVFADKILQMDQKGAP
RMIQPSQGVHLVLPQHFLGGQDALMIPKTSDGRVLFAVPWQGKLVVGTTDTIRAKTKMEP
EALSREINFILANAGQYLSKKPTRKDVLTVYAGLRPLAAPKGESVKTKEISRNHKVIISD
SGLTTLTGGKWTTFRKMGEDTVDHFPRVTGEEIKESHSWEIKLHGHGDPTLDDKHWKIYG
TDAVKILQLIKENPPYAKLLHPQYPYVAGEVIWAIREEMAMHIEDFLARRIRILLLDAAA
AIAMAPLVASLMAAELKKDKNWIDNEVSAFTKIAEKYLIKP