Protein Info for Echvi_1770 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR01311: glycerol kinase" amino acids 6 to 497 (492 residues), 753.4 bits, see alignment E=4.2e-231 PF00370: FGGY_N" amino acids 8 to 253 (246 residues), 282.3 bits, see alignment E=3.6e-88 PF02782: FGGY_C" amino acids 263 to 451 (189 residues), 160.3 bits, see alignment E=5.8e-51

Best Hits

Swiss-Prot: 64% identical to GLPK_PARD8: Glycerol kinase (glpK) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 73% identity to mtt:Ftrac_3763)

MetaCyc: 60% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.30

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZK2 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Echvi_1770 glycerol kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTQNKQFIMALDQGTTSSRAILFDQSGQSIAIAQKDFKQHFPKAGWVEHDAKEIWTSQAA
VILEAIAQAEIEPGQVAGIGITNQRETTILWDRKSGKPLYRAIVWQDRRTSAYCNRLKRE
GYRDMINQKTGLIIDAYFSATKIKWILDNVEGVREKAEKGEVCFGTVDSWLVWKLTNGQQ
HLTDITNASRTMLFNIHDKQWDEELLELFDIPKSILPEVRSSSEVYCTTAGDIFSAKIPI
GGIAGDQQAALFGQRCTQPGMVKTTYGTGCFMVMNTGEKPVQSSNQLLTTIAWEVAGKVH
YALEGSVFIGGAAIQWLRDGLAIFEEAEQSESLATSVEDNGGVYFVPALTGLGAPYWDQD
ARGAFFGITRGTTQAHFARAALEAIAFQVFDVLAAMEKDAGAKTKEMRVDGGASANNFLM
QFQADLLRSEVKRPQITETTALGAAFLAGLAVGYWKDQTELQQLWKEEASFPPKSDRNVT
DELLHFWHKAVQRSKDWVEE