Protein Info for Echvi_1762 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00152: dephospho-CoA kinase" amino acids 8 to 183 (176 residues), 120.1 bits, see alignment E=5.1e-39 PF01121: CoaE" amino acids 8 to 182 (175 residues), 150.9 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 40% identical to COAE_BACTN: Dephospho-CoA kinase (coaE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 56% identity to mtt:Ftrac_1919)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXM2 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Echvi_1762 dephospho-CoA kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MQNHKPLLVGITGGIGAGKTTAAKIFQTLGIPVYYADDRAKWLMANSPSLKEQIAAQFGK
EAYHEDGTLNRPFLAGKVFSDPEQTKRINGLVHPAVKDDFEAWAARQDAPYVLKEAALLF
ETGSYQDLDHVIHVFAPVDLRISRVLSRDAHRSREQVLAIMERQWSDTQKNKQADFTISN
KENQMLIPQVMKVHKALSEKA