Protein Info for Echvi_1760 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: preprotein translocase, YajC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 17 to 96 (80 residues), 86.9 bits, see alignment E=3.7e-29 PF02699: YajC" amino acids 21 to 95 (75 residues), 100.5 bits, see alignment E=1.9e-33

Best Hits

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 63% identity to mtt:Ftrac_1917)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZJ3 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Echvi_1760 preprotein translocase, YajC subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MTNTILLQAQGAGGSGIMGQVFLFGGIILIMYFFMIRPQQKKQKDAKNFIESIKKGDQVV
TIGGIHGKVYAIEGETVLIELDKGLKIKVEKSAVSAEFSKKSSGTK