Protein Info for Echvi_1757 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: transcription antitermination factor NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 116 to 130 (15 residues), see Phobius details PF01029: NusB" amino acids 254 to 374 (121 residues), 88 bits, see alignment E=3.7e-29 TIGR01951: transcription antitermination factor NusB" amino acids 260 to 376 (117 residues), 100.5 bits, see alignment E=4.4e-33

Best Hits

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXL8 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Echvi_1757 transcription antitermination factor NusB (Echinicola vietnamensis KMM 6221, DSM 17526)
MLNRRILRVKAFQSLYAYEQCKASNLNLAKDYVRDAFQPDLNSMEVQDKGQLRKDAEETI
TLFSKNLNNKALIASGDYATKVKSEAIKAINLYHQKNQKDLDFLRNNMVDAAEHIPALYL
LAIQILVGFSEHVQREYDRKRKLNQEQVSSVSGELNLANNKVIDYLKGAPAFTTASIRQQ
ADVEDLEMEIQEWYREYVKPWERYQEYMQLSEPTMEEDLDILMDLTKKILFKTDAILSLF
SEKDLSWTENKAVVRSLAIKVLKNVLEAENQEEYSLPEIAINWEEDKEFFQNIFNLTIEN
DEANRALIAEKTKNWDIERIASTDKIIISMAVTEMLFFPSIPVKVTINEYIDISKTYSTP
KSKQFVNGLLDVLAKELTDQGKIRKSGRGLLDNK