Protein Info for Echvi_1756 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glutamate dehydrogenase/leucine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF02812: ELFV_dehydrog_N" amino acids 35 to 142 (108 residues), 100.4 bits, see alignment E=6.7e-33 PF00208: ELFV_dehydrog" amino acids 153 to 210 (58 residues), 23.8 bits, see alignment E=3.5e-09 amino acids 220 to 357 (138 residues), 51.1 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 56% identical to DHLE_THEIN: Leucine dehydrogenase (ldh) from Thermoactinomyces intermedius

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 64% identity to mtt:Ftrac_1913)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ69 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Echvi_1756 Glutamate dehydrogenase/leucine dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MIEVKTEEKIKEGSIYGQITSLGHEQLVICYDEPTGLKAIIGVHNTVLGPALGGTRMWNY
TSEQEAITDVLRLSRGMTFKAAISGLNIGGGKAVIIGDPKLKSEAFLRRFGRFVESLGGR
YITAEDVNMKTRDMEYIAMETSHVTGLPEIHGGGGDPSPVTAYGAYLGMKASAKKAFGTD
ALKGKKVAVQGIGQVGRHLIDHLVKEGAEIYVTDIFEDRLKEVATATGATVVAPDEIYDV
NMDIYAPCALGATVNDKTIDRLKCSVIAGAANNQLEDEQKHGQLLLEKGVVYAPDFLINA
GGLINVYAEYLGGYNREAAYQQAEKIYDTCLAILNKSEKERIPAQQAAIELAWNRIQSIG
KVKSSY