Protein Info for Echvi_1754 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Co-chaperonin GroES (HSP10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF00166: Cpn10" amino acids 13 to 116 (104 residues), 45.1 bits, see alignment E=4.2e-16

Best Hits

KEGG orthology group: None (inferred from 72% identity to cpi:Cpin_1274)

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVX1 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Echvi_1754 Co-chaperonin GroES (HSP10) (Echinicola vietnamensis KMM 6221, DSM 17526)
MRLTEDNKLKKLVVVGDRVLIKLKKANEKTSSGLYLPPGVQEKEKVQQGYIMKAGPGYPI
PMHVEEDEPWKEKDENIRYVPLQAKEGDLAIFLLNGAHEVIYEGEKFYIVSQSAILMLER
EEEL