Protein Info for Echvi_1747 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 58 to 80 (23 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 156 to 173 (18 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 439 to 461 (23 residues), see Phobius details amino acids 482 to 499 (18 residues), see Phobius details amino acids 505 to 522 (18 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 63 to 532 (470 residues), 383.2 bits, see alignment E=7.7e-119 PF01235: Na_Ala_symp" amino acids 117 to 539 (423 residues), 406.7 bits, see alignment E=7.1e-126

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 69% identity to fbc:FB2170_16246)

Predicted SEED Role

"Na(+)-linked D-alanine glycine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXK7 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Echvi_1747 amino acid carrier protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MYRKLLSFLIFLFPMSLLAQEAVPTEELSFGQRIDRSFQPLADAWESLVLYPIPIAGYDI
PIVLILLVSGATFFTIYFAVPGITKMPLSINTVRGKYDDLERNYRDPENPDVIPDEAKGG
EVSHFQALATAVSGTVGLGNIAGVAVAIALGGPGATFWMIVCGLLGMSTKFVECTLGVKY
RDIEDDGTVHGGPMYYLSRGLGHDLKKGRLGQFLGGLFAVLCVGASFGGGNAFQSNQASS
QLANLLNINFQTNGFWIGVVLAVLVAIVIIGGIKRIATITEKVVPFMAAVYVLASLIILG
AHYDYVDDAIGLIIEGAFTPMAGLGGMLGVLIVGFQRAAFSNEAGAGSAAIAHSAVKTKF
PASEGVVALLEPLIDTVIVCTMTALVIIFFNIDGGLNNVESIFNYGGDGSGNVVLKETGA
SIGGVELTTMAYDSVIPHFSYVLTVAIILFAFSTMISWSYYGLQSWKYLFGRSKAADLTY
KLLFIAFIVIGASTTLNAVVKFSDAMILALVFPNMIGLFFLFPKVKLELKRYLAAIKSQK