Protein Info for Echvi_1746 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 11 to 306 (296 residues), 222.1 bits, see alignment E=2.8e-69 PF02719: Polysacc_synt_2" amino acids 11 to 205 (195 residues), 56.7 bits, see alignment E=8e-19 PF01370: Epimerase" amino acids 12 to 233 (222 residues), 102.5 bits, see alignment E=8.7e-33 PF16363: GDP_Man_Dehyd" amino acids 12 to 300 (289 residues), 71.3 bits, see alignment E=3.6e-23 PF01073: 3Beta_HSD" amino acids 12 to 162 (151 residues), 40.8 bits, see alignment E=5e-14 PF13460: NAD_binding_10" amino acids 15 to 170 (156 residues), 43.5 bits, see alignment E=1.2e-14 PF07993: NAD_binding_4" amino acids 76 to 175 (100 residues), 29.6 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 61% identity to mtt:Ftrac_2769)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ57 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Echvi_1746 dTDP-4-dehydrorhamnose reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNTPKKNKPTLLVTGANGLLGQKLVNRLLEKDSFHVIATGRGACRLPQTWEGFTYASMDI
TDKENVLEVFQRYSPEVVIHGAAMTNVDECETAQEACYQQNVAAVGNIIVAAEQYHSFLV
HVSTDFIFDGEAGPYTEDAVPNPVNYYGETKLQAEALIQQSSLNWGIARTVLVYGISHDM
SRSNIVLWVKKSLEEGKDLQLVDDQLRTPTLAEDLAEGCILMAEQRAKGVFNISGDELLT
PYDMAIQTAEFFKLDKTKINKTDSSAFRQTAKRPMKTGFVVQKAKDQLNFKPKSFTEGIE
ILAKQLNLAN