Protein Info for Echvi_1739 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: ribosomal protein L31
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to RL31B_DICNV: 50S ribosomal protein L31 type B (rpmE2) from Dichelobacter nodosus (strain VCS1703A)
KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 76% identity to dfe:Dfer_3270)Predicted SEED Role
"LSU ribosomal protein L31p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FVV9 at UniProt or InterPro
Protein Sequence (81 amino acids)
>Echvi_1739 ribosomal protein L31 (Echinicola vietnamensis KMM 6221, DSM 17526) MKKDIHPNYREVVFYDTSSEYKFLTKSTIETDETITWEDGNEYPLYKVEVSSNSHPFYTG KKMLLDTAGRVEKFNRRYKKK