Protein Info for Echvi_1734 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cystathionine beta-lyases/cystathionine gamma-synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF01053: Cys_Met_Meta_PP" amino acids 4 to 365 (362 residues), 409.4 bits, see alignment E=1.7e-126 PF00155: Aminotran_1_2" amino acids 50 to 192 (143 residues), 25.7 bits, see alignment E=1e-09 PF00266: Aminotran_5" amino acids 110 to 193 (84 residues), 24.1 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 45% identical to METB_MYCTU: Cystathionine gamma-synthase (metB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 58% identity to phe:Phep_1876)

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48, 4.4.1.1

Use Curated BLAST to search for 2.5.1.48 or 4.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVV4 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Echvi_1734 Cystathionine beta-lyases/cystathionine gamma-synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFETLAIHGGEKKSAPHRAVVQPITLSTTFEHHEESLIYSRSQNPNRMALEELLAQLEK
GSAAAAFSSGNAAGMAVFQALPLGSHIVAPSDMYHGLKKQLVELFKDKLEVTFTDLSDPE
NLEKAIQPNTKLLWIETPSNPMLKISDIRRLTKMAKEDDIRVVCDNTFATPVFQNPLELG
ADLVMHSATKYFGGHSDILGGALITKKSDEFWKQIVNVQQTGGAVLSPFDCYLLVRSIKT
LAYRMRGHAEHAGMIATFLDQHPKVERVFYPGLTAHPGHDVAKSQMTGFGGILSFLVKGK
PEDADKLISSLKYYTNATSLGGVESLIERRAAVEGPDTKTPQNLIRLSVGLEHLDDLLED
MEKAFYSIG