Protein Info for Echvi_1728 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pseudouridylate synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 8 to 240 (233 residues), 192.4 bits, see alignment E=4.7e-61 PF01416: PseudoU_synth_1" amino acids 12 to 107 (96 residues), 32 bits, see alignment E=7.5e-12 amino acids 144 to 246 (103 residues), 80.7 bits, see alignment E=5.2e-27

Best Hits

Swiss-Prot: 50% identical to TRUA_BACTN: tRNA pseudouridine synthase A (truA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 55% identity to fjo:Fjoh_4667)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY90 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Echvi_1728 pseudouridylate synthase I (Echinicola vietnamensis KMM 6221, DSM 17526)
METIRRYFLEVAYKGTNYHGWQVQPNAQTVQEAINKALSTILRKEVDTMGSGRTDTGVHG
KQQFLHFDWKGELDKGLFLKKTNAVLPKDISLYDLREVHPDAHARFDAEWRSYEYHISLR
KNPFEETLSWHCFYQLDIAKMNDAADLLLSHRDFECFSKVKTEVNHFECEIKTAFWEQKD
QHLVFHITANRFLRGMVRAIVGTLVEVGKGQLDLTGFQRILESKDRGKAGVAAPPHGLFL
SKVTYPEKIFI