Protein Info for Echvi_1709 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details PF25539: Bestrophin_2" amino acids 10 to 284 (275 residues), 182.5 bits, see alignment E=6.6e-58

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVQ3 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Echvi_1709 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIITHDIRLSRIVRGTWKNTILVALTCSMAYFFYRYFVQYHFEMPAIIPTILGTALAFFI
GFNNNQAYDRWWEARKIWGTLVNSSRTWARHVLQFPVASEHIKDQHLQLMKEYAIKRHIA
FLYALKENLRGTDEHEYKKYLIQSDLDIIENESNKHNAILSLQTTELKTWRKEKLIDGFE
FLELNREITRFCDEMGKSERIKNTVFPTSYNYYTKAFIWLFNIAFTLAVAPTVEWRAIAF
GTIIGYVFHTIHFIGQAILNPFEPIPTGIPLDQITRTIEINLLEMIHEEHIPDPVSPIND
EYVM