Protein Info for Echvi_1703 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07944: Beta-AFase-like_GH127_cat" amino acids 45 to 451 (407 residues), 373.6 bits, see alignment E=2.3e-115 PF20736: Glyco_hydro127M" amino acids 462 to 558 (97 residues), 92.5 bits, see alignment E=3.1e-30 PF20737: Glyco_hydro127C" amino acids 560 to 675 (116 residues), 84.6 bits, see alignment E=6.3e-28

Best Hits

KEGG orthology group: K09955, hypothetical protein (inferred from 66% identity to fjo:Fjoh_4097)

Predicted SEED Role

"Putative glycosyl hydrolase of unknown function (DUF1680)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY45 at UniProt or InterPro

Protein Sequence (679 amino acids)

>Echvi_1703 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLKYVIAGIGMGIFTSHSAMAQHEGLVDNSQSPYAKLKSVNLQDVTWTDGFWGEKFKIS
REQTMPFMWALYHDADQNHAVRNFEIAAGEMKGKHDGPSFHDGDFYKVFEGMAALYAETK
DPELDAQMDEAIALIAKAQREDGYLHTPVLIEERWGTLGDEYLQKQLGFEKYNMGHLMTA
ACVHYRATGKDNFLDIAKGVADFLYDFYKEASPALARNAICPSHYMGVVEMYRTTDDKRY
LELAQNLIDIRGKTDDGTDDNQDRVPFREQTEAMGHAVRANYLYAGVADLYAETGEEKLL
ENLKSIWEDVVYRKMYVTGGCGALYDGVSPNGTSYNPTEVQKIHQAYGKPFQLPNAAAHN
ETCANIGNVLWNWRMLQLTGEAKYMDVIELNLYNSILSGISLQGTEFFYTNPLSAKKDLP
YHLRWPNTREGYIALSNCCPPNVARTLAEVANYAYSTTEDGLYVNLYGSNKLQTTLADGQ
ELLINQSTSYPWDETISLDIEKAPKDDYSVFLRIPGWCHEASVTVNGEEQHMDLAAGQYV
EINRSWKKGDQVTLTLAMPVQYLEANPLVEQARGQVAVKRGPVVYCVESMDLPAGKSVDD
VVIALSEELSPEAFTIGNSELISLTGEVYYQSEDNWENQLYREVSDSGFEKGNIRLIPYY
SWANRGDGEMMVWLPYERK