Protein Info for Echvi_1692 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Ribulose 1,5-bisphosphate carboxylase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF02788: RuBisCO_large_N" amino acids 7 to 123 (117 residues), 33.5 bits, see alignment E=4.4e-12 PF00016: RuBisCO_large" amino acids 133 to 410 (278 residues), 262.1 bits, see alignment E=6.4e-82

Best Hits

Swiss-Prot: 52% identical to OIAT_XANP2: 3-oxo-isoapionate-4-phosphate transcarboxylase/hydrolase (oiaT) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01601, ribulose-bisphosphate carboxylase large chain [EC: 4.1.1.39] (inferred from 77% identity to phe:Phep_2747)

MetaCyc: 52% identical to 3-oxoisoapionate-4-phosphate transcarboxylase/hydrolase (Xanthobacter autotrophicus Py2)
RXN-20936 [EC: 3.7.1.28]

Predicted SEED Role

"similar to ribulose-1,5-bisphosphate carboxylase, Type III"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.28 or 4.1.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXC5 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Echvi_1692 Ribulose 1,5-bisphosphate carboxylase, large subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MERISATYYIETPFEVESAAAVLAGEQSSGTFVAVPGETAELKQRFAARVESIEKLETVS
QPAIPGAVSSHGKYHRAMISVSWSIENFGYNLPTMISTLQGNLYEITQFTGLKLMDLEVP
ASFAQHFAGPAFGIKGCRELTGVEAGRPLIGTIIKPSIGMRPEETAALVKTLVEAGIDFI
KDDELMGSAANSPFDKRVEAIMRVINAHADKSGKKVMYAFNISDEMDRMHEHYDTVVKHG
GTCAMMSINSVGMAGVKRICDRRELAIHAHRNGWGMLNRHPLLGIDFRAYQKLWRLAGVD
QLHVNGIQNKFWESDDSVVRSIAGCLTPMLGGYQVLPVVSSGQWGGQAPETYRRTETTDL
LYMAGGGIMAHPAGPAGGVKALQQAWRAAVDGLSVEEAAKKYEEFGLSVQKFGK