Protein Info for Echvi_1687 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted acyl-CoA transferases/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF02515: CoA_transf_3" amino acids 4 to 371 (368 residues), 338.6 bits, see alignment E=2.5e-105

Best Hits

KEGG orthology group: None (inferred from 58% identity to psn:Pedsa_0472)

Predicted SEED Role

"Probable racemase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXC1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Echvi_1687 Predicted acyl-CoA transferases/carnitine dehydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPLLEGITIVDFSQFLSGPSASLRLADFGARVIKVEKPKTGDICRQLYVSAVEIAEESTI
FHTINRNKESFTADLKEKADQEAIWKLIGAADVVMHNFRPGVMARLGFSYDEVKARFPQI
IYAEISGYGQDGPWADLPGQDLLLQSLTGLTFLNGEEYKAPTPMGISVVDLLAGTQLAQG
ILAALYRKEDTGRGSLVQVSMLESAMDFQFEVFTTFLNDGEELPQRSKVNHGHCYIAAPY
GVYETKDGFLALAMGNIVTLGDLLACEELAVFDDPKGWFDRRDEIKAVLAAHLANNTTQH
WLDILEPADIWCAKVLDMEAMMEEEGYQVLEMEMEVRTTNGDRIRTTRCPIRVNGERILP
GRGAPFLGEHNDALAREFGL