Protein Info for Echvi_1686 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted acyl-CoA transferases/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 175 to 196 (22 residues), see Phobius details PF02515: CoA_transf_3" amino acids 14 to 379 (366 residues), 321.2 bits, see alignment E=4.9e-100

Best Hits

KEGG orthology group: None (inferred from 54% identity to str:Sterm_3487)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYX0 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Echvi_1686 Predicted acyl-CoA transferases/carnitine dehydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNPESKSTTKSLPLEGVIVLEFCQYLSGPSAGLRLADLGARVIKIENPGKGDLCRILPIK
NRWVENDSLLFHTINRNKESYTANLKSEHELAEIKRLIGKADVLMHNFRPGVMEKLGLGY
EAVKALNAGLVYAEISGYGAEGPWARKPGQDLLLQAMSGLMFASGNQKDGPMPFGLAIGD
MLCGAQAVQGILAALVHRKRTGKGSRISLSLLESLLDMQFEVLTTYFASGKRPLRSAVNS
AHPLLGAPYGIYATKDSHLAIAMIPIAPLREALGCGELERFDQSMVFTHRDAIKQVLADF
LKSATTDHWLAKLREKGLWAMDVKDWKQLKATQGYRQSNLEQIIKLTNGQSIKTNRCPIR
IDGEVLLSDRPAPTLGEHTASIKQEFN