Protein Info for Echvi_1679 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF23169: HalD" amino acids 9 to 127 (119 residues), 31.9 bits, see alignment E=8.9e-12 PF05721: PhyH" amino acids 13 to 215 (203 residues), 104.3 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: None (inferred from 46% identity to pbs:Plabr_3031)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVM3 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Echvi_1679 Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNILTDEQLNQFKEDGFCIVKNVIPKELLKRLQDECQRFMKEKDDEMDRKGVEVDEINH
KGKRYFIALRYKDSETMQDLIFGKEMEEITRKILGEDVYLFLEQFVVKAADKGMTFSWHQ
DSGYLDFEHKPYLSVWCPLDDVTEENGTVYLLPYKDAGTKNRIDHELQEGTNDKVGYFGD
NPGIPAILKAGDVALFSSTCFHRSGSNKTGKSRRVLLIQYSAEPIMKGDKPLYWADPFVV
NGDRKKEVPA