Protein Info for Echvi_1647 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FOG: PKD repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00801: PKD" amino acids 37 to 97 (61 residues), 49.1 bits, see alignment E=4.3e-17 amino acids 122 to 168 (47 residues), 31.7 bits, see alignment 1.1e-11 amino acids 196 to 247 (52 residues), 51.9 bits, see alignment 5.7e-18 PF18911: PKD_4" amino acids 42 to 101 (60 residues), 59.8 bits, see alignment E=2.3e-20 amino acids 121 to 182 (62 residues), 45 bits, see alignment E=9.1e-16 amino acids 186 to 259 (74 residues), 64.3 bits, see alignment E=8.7e-22

Best Hits

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX78 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Echvi_1647 FOG: PKD repeat (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNNYGNLKCLTILFLSFVLFTSCKEEDMKPVEPSAGFTAATNELEATFTNSSENVTSYS
WNFGDGNTSSEENPTHNYEAAGIYTVVLTAKGANGSIAEADKDITIVENLKADFGFESEY
LTVTFSNTSENSVSYSWDFGDGNTSTEEEPVYSYEEGGTYEVVLYSTAPGGTTVQTTKEV
TVVGPPVADYIAEDEGLTVNFTNTSENVISYSWDFGDGGTSTEESPSHTFAAAGTYTVVL
TATDEDGVVVETSQEITVEVPIDTSLYSIVFITDDSLDDPQIEWLREKGFNVSTYYNGSL
SSAPQEDIDMLNAADLIIIGRSGGSADFDAPDKQVWNALTPPLILNSQWMARNNRLNWFD
NNGNPAAFNPTGGDVVTAQIPNAEDEAFDEVTLEEGNLLSWINPPANLLYINTETNGDIM
AMTAPGSGGSDEGGAMLYVRFTAGVEFYSGAGESPAGPRTYFGFGADEGGVSYYWELTDE
AKAVYFEEILRMVLM