Protein Info for Echvi_1613 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Chloride channel protein EriC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 156 to 183 (28 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 316 to 326 (11 residues), see Phobius details amino acids 335 to 337 (3 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 380 to 407 (28 residues), see Phobius details PF00654: Voltage_CLC" amino acids 71 to 402 (332 residues), 241.9 bits, see alignment E=5.8e-76

Best Hits

Swiss-Prot: 50% identical to ERIC_PSESM: Chloride/fluoride channel protein (eriC) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 58% identity to hhy:Halhy_0829)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXU7 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Echvi_1613 Chloride channel protein EriC (Echinicola vietnamensis KMM 6221, DSM 17526)
MLEKARDLIHVKRFFTKEFVPSIQYTIKWLVLAIFIGLLVGTASAFFLFGLEWATLFREE
HVYMIALLPVGGFAIGWVYHKYGQSVVKGNNQLLEEFYNPLTPIPLRMAPLVVFGTIATH
LFGGSAGREGTAVQMGGAIADRFTKWFKLDAIDRKAIITLGVAAGFASVFGTPLAGAIFA
LEWLIVGRVRYEAILPAFLGAYVADYACADFWHAHHTPYEIPFIPSLTLLNILWIIPAGI
CFGLAARLFSKATQFFGAAFKTSVRYPPLRPVIGGAMVAVLVFMIGTTKYIGLGVPTIEE
AFNAPLPWYDFLAKTGFTSLTLGAGFKGGEVTPLFYIGATLGNMLSGVIPLPMALLAGMG
FVAVFSGATNTPLSCTLMGIELFGAESGVYVGLACVLAYLFSGHSGIYGSQVIGSPKHIS
LDQNKGKSLGKLD