Protein Info for Echvi_1594 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 29 to 104 (76 residues), 39.5 bits, see alignment E=1.2e-13 PF13715: CarbopepD_reg_2" amino acids 30 to 122 (93 residues), 38 bits, see alignment E=2.7e-13 PF07715: Plug" amino acids 136 to 226 (91 residues), 25.5 bits, see alignment E=3.1e-09 PF14905: OMP_b-brl_3" amino acids 383 to 786 (404 residues), 390.8 bits, see alignment E=1.6e-120

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVD4 at UniProt or InterPro

Protein Sequence (810 amino acids)

>Echvi_1594 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MKISYQLCTVLFFFLLASGHAVARQHTELKGSVEDVDGVALPFANVSVLEKEGGRMVVGA
VSDENGDFLISTSKTGEVILSISSIGYKTYQTSPFTLESGMKKDFGTIQVEEEATSLDAV
EVRSSRPEVIIEADRTVVNVEGTVMAEGSTALDVVGRSPGVYVDADGNINLNGRSGVIVL
IDDRQTYMSAKDLANFLRAMPADNIKSIEVINNPPAKYDAEGAAGVLNIQLKKNDYNGMN
GSIQAGHYYNGRHAPFAGGSLNLKRGKWTTNLSLNYNTWVRDIDLQILRRFKEENGTSEF
DQDALLQLGEENFFLSGGADYQINTKHSVGFSFQASDRDGEENGDSRTDISNPDNPDINH
LQALNDSESGNTRVFTNFHYVGNLDTLGTKLSADVDYTVVDGGSLSLLTNNYWVNEATEA
GTMDRIRTDNDMAYTIFTAKADFTKPLSEKVKLETGVKGSWVESDNMLDISKSTEDGPFE
PDQNSNHFIYNENVLAAYASVKSPLGKKLDFQAGLRMEYSDITGNSVTLNQVNKQEYLNL
FPSMFLQHKVSDNYSIIYNVNRRITRPNYRLLNPFVFYVDPLTTEKGNPNLQPQYANNFE
MSHVFKQAYQFTLAYSRTTNSIDQVMIQNDETKETTLQVQNFDKSEDFSLRMMVPVEIAE
WYSTSNMLHLYYKAYQSQLGDDFLDVSQFSYMARTQHNITLPKGFKVELVGMYISPFLEG
QMKFNGFGWVDAGVTKSFKDDKFSVTVNGQDIFRTRGIKGGVNFADINTDIRQYNSQQAV
RVTFRWNFSKGEKFKVSNRSGSAEERNRLD