Protein Info for Echvi_1590 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/phosphate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 50 to 87 (38 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 26 to 115 (90 residues), 76.5 bits, see alignment E=1.1e-25 amino acids 207 to 316 (110 residues), 63.9 bits, see alignment E=8.7e-22

Best Hits

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYY1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Echvi_1590 Na+/phosphate symporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MTELTQKKDYTKRWIMAAQMLFALILFMTSIDLLTVSLLNMNNEVANEIFLATSNPFIGL
FIGLLMTGLIQSSSTVTAMVVAVVASGNLSLTQAVPIVMGANIGTTITSTLVSFTYIMKK
SEFRKAISAGILHDLFNIITVIILLPLEYYFNFLSKLASFFSQSLFSLTSGVEGDYSYNI
IFTRSLSKLIIDWIQIPVLALAISVVLLFLSIKILSSTVYKTFISSSFKEVSKHIFKYPY
RSFAYGVFFTAAVQSSTVTTSLLVPAVATKKVSLNKVFPFIIGANIGTTITAAIAAIYKT
EAAIAIAIVHFLFNFIGALIFLPYAGLRNIPVKLAIYFGKNAAKKKVIGVAYILLTFFII
PFILIYLNKDGDTENLEVDKEKVEIQATQPFKAPSNENK