Protein Info for Echvi_1581 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Lysophospholipase L1 and related esterases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 52 to 220 (169 residues), 73.8 bits, see alignment E=2.3e-24 PF13472: Lipase_GDSL_2" amino acids 54 to 217 (164 residues), 106.1 bits, see alignment E=3.2e-34

Best Hits

Swiss-Prot: 39% identical to EST_PSEAE: Esterase TesA (tesA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 61% identity to gfo:GFO_1948)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYK6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Echvi_1581 Lysophospholipase L1 and related esterases (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKIRVFSVLTVFFLVALGTFSCSESQQTSDKEASSSKADTEKENQVPKKTILFFGDSMT
AGYGVDQDEAFPALLQHKIDSLNLPYKVINGGLSGETSASGLTRIDWFLESKPDIFILEL
GGNDGLRGIALSSTKDNLQGIIDKVKEKYPSTKIILAGMQIPPNMGEAYTTDFKEIFPSL
AEQNDLLLIPFLLDGVGGNPDLNQPDGIHPTAEGHKIVAKTVWKYLEPEL