Protein Info for Echvi_1574 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): Rhamnulokinase (EC 2.7.1.5)
Rationale: Specifically important for utilizing L-Rhamnose monohydrate. Automated validation from mutant phenotype: the predicted function (2.7.1.5) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Sugar (pentulose and hexulose) kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00370: FGGY_N" amino acids 7 to 215 (209 residues), 63.7 bits, see alignment E=2.1e-21 PF21546: FGGY_C_2" amino acids 246 to 441 (196 residues), 42.3 bits, see alignment E=7.1e-15

Best Hits

Predicted SEED Role

"Rhamnulokinase RhaK in alpha-proteobacteria (EC 2.7.1.5)" in subsystem L-rhamnose utilization (EC 2.7.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVB3 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Echvi_1574 Rhamnulokinase (EC 2.7.1.5) (Echinicola vietnamensis KMM 6221, DSM 17526)
MTPIPVIAIFDIGKTNKKFFLFDEHSNEIKQEYNKIPLTEDEDGFECDDLVALSEWITST
VEEICQSPDYALKGINFSTYGASFVHIDADGNPLTPLYNYLKEIPQEIIDEFYRQYPEET
NNLETASPSLGMLNSGLQLYWLKKTKPDLFSKIAYSLHFPQYLSYLFTKKAVSEPTSIGC
HTRLWDFQKDQYHDWVKQEGIDRVLPDIVPTGQLYQVDLCGRKVDIGVGIHDSSSALASY
LVRVKEPFLLISTGTWSISLNPFTTDPLTKDELHNDCLNFLSIEGKPVKASRFFMGYEFN
YQIDRINKHFGKPDKFYKSVPANPAIIKAIKTGKVSNTFYPRHIAETPLVKALYEGNEWN
PASFANFDEAYHHLIWGLTLLQVESLKLARGNSGIKKVFIDGGFVHNEVFMELLRYYLPE
SELEFSDFPLGSAYGAALVLEASEKKMA