Protein Info for Echvi_1573 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): L-rhamnose isomerase (EC 5.3.1.14)
Rationale: Specifically important for utilizing L-Rhamnose monohydrate. Automated validation from mutant phenotype: the predicted function (5.3.1.14) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Predicted sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to RHAL_RHIME: Probable sugar isomerase R00627 (R00627) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 66% identity to zpr:ZPR_1550)

Predicted SEED Role

"L-rhamnose isomerase (EC 5.3.1.14)" in subsystem L-rhamnose utilization (EC 5.3.1.14)

MetaCyc Pathways

L-rhamnose degradation I (5/5 steps found)
superpathway of fucose and rhamnose degradation (7/12 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXQ2 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Echvi_1573 L-rhamnose isomerase (EC 5.3.1.14) (Echinicola vietnamensis KMM 6221, DSM 17526)
MRIDKQKIKEVNDQALSEHRESFGHLSSVLGKKGIDVNVLVEKLKEFQVAVPSWALGTGG
TRFGRFSGGGEPGTLEDKISDVGLLHQLSQSAGAISLHIPWDIPNDVQAIKELAASHGLI
FDAVNSNTFQDQPDQELSYKFGSLCHADKKVRDQAVKHNLEVIKYGDALGSKSLTVWLAD
GSSFPGQLNFKKAFQRTLESLQEIYAGMPEDWKLFVEYKPYEPNFYSTVIQDWGTSHMLA
DKLGDRAYSLVDLGHHLPNTNIEQIVATLMMVGKLGGFHFNDSKYGDDDVTVGSLKPYQL
FLIFNELVDGMEDPSSNNPYPAWMIDASHNLKDPLEDLLQSLEAIKLAYAQALLVDRDAL
EEARENNDPALAQEILQAAYRTDVRSLLAEARLQADGALDPIAAYRKLNVRKELIAQRGE
KVISTGL