Protein Info for Echvi_1562 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 229 to 256 (28 residues), see Phobius details amino acids 264 to 280 (17 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 332 (318 residues), 184.1 bits, see alignment E=2e-58

Best Hits

KEGG orthology group: None (inferred from 58% identity to shg:Sph21_3671)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWY9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Echvi_1562 Predicted permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKQYPSSIILAAKLIVLFLTVAIAYFLKSVLVPLMFALVISIMLFPICNFLEKMKLPRA
AASIISVIIATLVLSALLYFIVHQVIVIGKDGQDIAHNFGMIYDSIQGWLESTFGLRPGE
LTQRIREAGQKQLSGVGKYLTSVFSSAGGTLANGVLVPLYTFFFLYYRDFFKDFLIQAVK
GAPASKVMDTINRIYHVIQSYLLGLVTVMGIVAVLNTVGLLIMGLEYAWFFGTLAAILIL
IPYIGVAIGSLVPALFALATMDSYWYALGVIGWFQVVQFLEGNFITPNIVGGKVSLNPLV
AIISLLLGGMLFGLGGLILALPMVAVMKIIFEMTDATQPFSFLIGEPDADHIKKDSFDRL
REKHKLDKPSDE