Protein Info for Echvi_1539 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR00082: ribosome-binding factor A" amino acids 1 to 112 (112 residues), 60.6 bits, see alignment E=1e-20 PF02033: RBFA" amino acids 5 to 109 (105 residues), 96.1 bits, see alignment E=7.5e-32

Best Hits

Swiss-Prot: 51% identical to RBFA_CYTH3: Ribosome-binding factor A (rbfA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 51% identity to sli:Slin_0998)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV75 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Echvi_1539 ribosome-binding factor A (Echinicola vietnamensis KMM 6221, DSM 17526)
MESKRQQKYSKLIQKELGDIFQRESKPLVGNAMVTVTRVLMSPDLGVAKIYLSFLLANNQ
ELLEKIDAHKKEIRKHLGKRIGKSVRSIPELVFYPDDSSAYAQHMDKIIGGLDIPEAPDD
EEEED