Protein Info for Echvi_1536 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphatidylserine decarboxylase precursor-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 39 to 219 (181 residues), 155.2 bits, E=7.6e-50
• PF02666: PS_Dcarbxylase
  • amino acids 48 to 214 (167 residues), 139.4 bits, E=6.2e-45

Best Hits

Swiss-Prot: 55% identical to PSD_CYTH3: Phosphatidylserine decarboxylase proenzyme (psd) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 63% identity to mtt:Ftrac_2765)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (6/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (8/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See L0FYF9 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Echvi_1536 phosphatidylserine decarboxylase precursor-related protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTIHKEGRTLLFWMLVVLAGINFATHQWLPGQDTVLNLILLASIIIYLLVLQFFRSPTIP
MPVDEQMVYAPADGKVVVIEEAQEDEFLKERRKQISIFMSPVNVHVNRSPVSGIVEYFKY
HPGKYMVAWHPKASYENERSTMVIRHTKTGVKLLVRQIAGAVARRIKYYVKEGDPVIQGG
EFGFIKFGSRVDVFVPLDAEILVNIDDKTKGGITPLARLK