Protein Info for Echvi_1534 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: CDP-diglyceride synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details PF01148: CTP_transf_1" amino acids 15 to 279 (265 residues), 180 bits, see alignment E=4.3e-57

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 62% identity to mtt:Ftrac_2763)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV70 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Echvi_1534 CDP-diglyceride synthetase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKYRFNISNYSELGQRIITALLGAAVIVFGSMYSEWAYFSIFGTILVLSQLEFYKLCGLD
GMLPLKTFGTFLGLMIFVMTFFVEMQHMDDKYYFLIFPMISLIFFIKLYRKSDKKPFTGI
AYTFLGIFYVAVPFSLLNLAAFSVDQTFHYEVIVGSLFILWASDSGAYFAGTKFGKTKLF
ERVSPKKSWEGSLGGAAAAIVTAYLLSLNFMVIPQWKWLSISGIIIIAGTYGDLIESLFK
RSIAIKDSGKGLPGHGGFMDRFDGLLVSAPFIAAFLKIF