Protein Info for Echvi_1532 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: CAAX amino terminal protease family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF02517: Rce1-like" amino acids 172 to 259 (88 residues), 70 bits, see alignment E=9e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWV8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Echvi_1532 CAAX amino terminal protease family. (Echinicola vietnamensis KMM 6221, DSM 17526)
MEIYKTQSQIAAKHNWLLSLVVLVLITFGVLALTQGIALVMIPFLFNISYEDILPLFTGE
LSYPNGRMAMLFLQGIGGGLAFFIAGWLFSKVVEKASLGWQQQFARVKFNYLLLLLPLLF
GFMLFDAKVIEWNMNINFPAFLEGFETFAREMEDQAMKMTKFLTDFQDFGEFLAGVLVIG
VLAGIGEEYFFRGVLQPKLHRYLGNAHAGVWLAAFVFSAIHFQFFGFFPRLLLGALFGYL
YLYSGSLVYPIVGHVLNNSFTIVMVYLNKLGVVEFDIEDPEGVSWYTVVLGLIVFVVCMR
LFVQQNKQKSSHGEVAEGI