Protein Info for Echvi_1531 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: putative TIM-barrel protein, nifR3 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 4 to 321 (318 residues), 333.5 bits, see alignment E=6.4e-104 PF01207: Dus" amino acids 15 to 319 (305 residues), 277.4 bits, see alignment E=7.3e-87

Best Hits

Swiss-Prot: 40% identical to DUS1_BACSU: Probable tRNA-dihydrouridine synthase 1 (dus1) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 70% identity to chu:CHU_0360)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYF4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Echvi_1531 putative TIM-barrel protein, nifR3 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MVKIGNLALGEFPLLLAPMEDVSDPPFRAVCKENGADLMYTEFISSEGLIRDAAKSVQKL
DIFEYERPIGIQIFGNEIDSMREAAAIAEQAGPDILDINYGCPVNKVACKGAGAGILLDI
DKMVSMTAEIVKAVNIPVTVKTRLGWDNNTIRIVEVVERLQDVGIQAISVHARTRKQMYK
GEADWTYLAKIKENQRIHIPLFGNGDIDSPERAREYRDRFGVDGMMIGRAAIGYPWIFNE
IKHYFETGQKLAAPGLDERINVAKKHLDFSVKWKGEKLGILEMRRHYTNYFRGMPNFKPY
RTKMVTADTYAEVSSLLDQVAVDFADYQFVSQG