Protein Info for Echvi_1529 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 286 (32 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 11 to 314 (304 residues), 165.5 bits, see alignment E=1e-52 TIGR00374: TIGR00374 family protein" amino acids 12 to 323 (312 residues), 59.4 bits, see alignment E=2e-20

Best Hits

Predicted SEED Role

"putative dolichol-P-glucose synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV64 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Echvi_1529 conserved hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MRLSIKQWIQVVVSLAVAIWIFWFLYKDVKMESLLEALQQASLFWICMSIWISVLGFGLR
SWRWKLLIDADLAEKLPTSRAFWGLMIGYLVNMLVPRAGEVARCGVLKKTDKLPVSKLLG
TVILERSVDLLFMIGVIFLAFVLEREVFVGLAEDLISLDAIKTGFKEYMPLLVGGVALLV
IVFYWVTSRYRDHGLVKKFHHFMRELIGGLKSVQRMKNRLGFWSASVGIWVIYFLMMYFI
AMAMPSTANLSPSSVLMVMVMGSIGMVAPVQGGIGTFHALVAFILMTYGLTEEEGKIFAI
IVHSSQVLIVLVAGVISLLVVAKISVTTKPQAGHLRNN