Protein Info for Echvi_1526 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 76% identity to mtt:Ftrac_2051)

Predicted SEED Role

"Similar to glycogen synthase (EC 2.4.1.21)" (EC 2.4.1.21)

MetaCyc Pathways

glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
starch biosynthesis (3/10 steps found)

KEGG Metabolic Maps

Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYF0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Echvi_1526 Glycogen synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKLRILYVASEINPFLQTSEVANFVRALPQAMQEKGMEIRILVPRFGLINERKNRLHEV
VRLSGINISVGEEEKPLIIKVASIPNAKLQVYFIDNEDYFQRKSVFHDKQEKFYEDNDER
AIFFCKGVIETVKKLGWAPDIVHCNDWMTSLIPLYLKTTYKNEPLFKNTKSVFTIYNNGF
NHKFDDDLLEKVKMVDIDDSILTPLKSKDYEGFLKIGMEYADVVIKGDEISENLNQIIEE
CSKDKKCDINNEDEEEQLFESYYNIYTDLAG