Protein Info for Echvi_1524 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glucosamine--fructose-6-phosphate aminotransferase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)
  • amino acids 2 to 613 (612 residues), 830.1 bits, E=5.4e-254
• PF13230: GATase_4
  • amino acids 33 to 156 (124 residues), 27.3 bits, E=3.3e-10
• PF13522: GATase_6
  • amino acids 66 to 196 (131 residues), 71 bits, E=2e-23
• PF13537: GATase_7
  • amino acids 82 to 199 (118 residues), 52.7 bits, E=8.2e-18
• PF01380: SIS
  • amino acids 294 to 422 (129 residues), 118.6 bits, E=3.4e-38
  • amino acids 467 to 595 (129 residues), 99.6 bits, E=2.4e-32

Best Hits

Swiss-Prot: 64% identical to GLMS_BACTN: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 74% identity to mtt:Ftrac_2053)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (3/5 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (3/6 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• chitin biosynthesis (4/9 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (4/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Glutamate metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

See L0FV59 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Echvi_1524 glucosamine--fructose-6-phosphate aminotransferase (isomerizing) (Echinicola vietnamensis KMM 6221, DSM 17526)
MCGIVAYVGKQEALPVIIKGLKRLEYRGYDSAGVALLNDAGLNVYKKKGKVSELENFIES
NPNLHSHIGIGHTRWATHGEPNDANAHPHYSASENFAMIHNGIIENYEVLKTDLINKGYT
FHSDTDSEVFINFIEDIYQNNNCSLEEAVRLALHKIVGAYAIVLMNKEEPDTLIAARKGS
PLVIGVGEDEFFLASDATPIVEYTNQVVYLDDYEIAVIRDAKLQIKTIENVETHPYINKL
DMELEAIEKGGYEHFMLKEINEQPRSIADCMRGRLDSRAGRLILGGLRDYMNKFQNADRI
IITACGTSWHAGLVAEYLFEEFARVPVEVEYASEFRYRNPVINSRDFVIAISQSGETADT
LAAIELAKQKGATIFGVCNVVGSSIARATHAGSYTHAGPEIGVASTKAFTAQISVLSMMA
LMLGYQRGTLPESKYMELLSELEAIPAKVEKALKLNEQIERIAAQYKDARNFLYLGRGYN
FPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDEEMPVVFIATQDSSYEKVVSNIQE
VKARKGKIIAVVTEGDQTVRKMADHVIEIPRAHEAFVPLISVLPLQQLSYHIAVMRGCNV
DQPRNLAKSVTVE