Protein Info for Echvi_1510 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: bacillithiol biosynthesis cysteine-adding enzyme BshC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 TIGR03998: bacillithiol biosynthesis cysteine-adding enzyme BshC" amino acids 14 to 510 (497 residues), 448.4 bits, see alignment E=2.1e-138 PF10079: Rossmann-like_BshC" amino acids 15 to 362 (348 residues), 418.6 bits, see alignment E=3e-129 PF24850: CC_BshC" amino acids 366 to 517 (152 residues), 130.3 bits, see alignment E=6e-42

Best Hits

KEGG orthology group: None (inferred from 46% identity to mtt:Ftrac_1928)

Predicted SEED Role

"FIG00651548: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYQ3 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Echvi_1510 bacillithiol biosynthesis cysteine-adding enzyme BshC (Echinicola vietnamensis KMM 6221, DSM 17526)
MLKSTVEPECTGQFSPLFIDYIRQQEKLVPFYHAYPTLENFKAVIENRHLEVSKRKVLSQ
ALKAQYEGVDISESVAENIAALESEKTFTVTTGHQLNLFTGPLYFIYKIVSTINLAKQLG
EAYPQYRFVPVYWMASEDHDFEEINYFRYEGNKYRWNTHQKGAVGDFALDASMEELLKEV
SFVPDFFKEAYRKNTTLAGAVREYVNHLFGEKGLVIVDGHDQQLKELFVPIMKAELLEGK
ANDLVNAQTQKLEELGYKSQIFPREINFFYLDKGVRSRIVKNAGVYEVLDTEKTFTPEEL
TKLVAEEPTRFSPNVVLRPLYQECILPNVAYLGGPAEVAYWLQLKGVFDHYDIAYPMIMP
RNFAMIKSVKAQRKASALALSDEQLFVDFEELKKDYVQSHAQSDLDLAEEKKALAAVFEQ
LGVDAAAIDPTLKPAAEAAKVRALKVLAHFGKKLRQGEERNMEVALRRLREVKEMLFPGG
APQERTCNFLEFYLANGHFIEELYGHFDPLDYRYIILVQDA