Protein Info for Echvi_1498 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: conserved repeat domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 832 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01451: conserved repeat domain" amino acids 286 to 315 (30 residues), 27.4 bits, see alignment (E = 1.1e-10) amino acids 399 to 429 (31 residues), 21.7 bits, see alignment (E = 6.6e-09) amino acids 504 to 553 (50 residues), 48 bits, see alignment 3.9e-17 amino acids 617 to 662 (46 residues), 39.4 bits, see alignment 1.9e-14 PF01345: DUF11" amino acids 502 to 597 (96 residues), 55.2 bits, see alignment E=1.3e-18 amino acids 612 to 730 (119 residues), 76.7 bits, see alignment E=2.8e-25 PF13585: CHU_C" amino acids 740 to 821 (82 residues), 72.1 bits, see alignment E=5e-24

Best Hits

Predicted SEED Role

"internalin, putative" in subsystem Listeria surface proteins: Internalin-like proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV34 at UniProt or InterPro

Protein Sequence (832 amino acids)

>Echvi_1498 conserved repeat domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKALLYSFLFWAACCFVHAAHGFDHEFNALSGKPTVDDVHLLLEKTGQYMDSNEDGEFSA
GDTVFYSFVVKNVCSGTISDIMVKDPAATLQGTPITLAPGEEDHSTFSAFYVLTQQDVDA
GVFKNTATVSGQLPSGEVVSAEDEDIQDIYVKGSIKLEKTGTYEDTNGDGQPSVGDHVHY
HFTVKNSCHATLYEVVVLDALVEISGGPITLAPGEKDKTTFSGSYALTQADIDAGTLVNT
ATAIGRNAHGESVKDSDEDVQDIYVKGSIKLEKTGTYVDTNEDGLPNVGDHVRYTFVVKN
SCHVTLTDVVVTDPLVEVTGGPITLVPGEKDKTTFSAVYALTQGDIDAGMLINEAVAKGI
NPHGEAIVDKDDDKQVFEVSGAIKLKKTGEYHDTNGDGFASPGDEIRYTFEVKNSCHVTL
RNVHILDTLVEVTGGPITLAPGQKDKTTFKATYTLTQADIDQGKVTNKATAVGENPKGEP
ITDCDTHTVILQGLGQPIGFDLTKEVDITRAVLGQQLTYTISLTNTSPVEVKDIRLLDPL
PEELTYVSSTLPRGADGGWEIAAMAPGEQLVVELSVMATQVGEVVNIVELTADDYQTQAE
AEAVVIRECNVDLAISKTSHGAKIYQGDEFSYTLTVQNNGEDTATDVVITDVLPDLVSYV
SSAYVPSSEDIVPQLQQEGSTLRWEIAHFPPGESVEIALTVKANGLGELLNEALVESPHE
EENPDDNADKDWNTIVEFFIPNVFTPGTKDNINDSFVIRGLQQFRQNNIVIMNRLGDHVF
EKENYQNDWDAKGLNGGAYFYVLSVTDTQGAHHVFKGWVQVIKGTTSNQTER