Protein Info for Echvi_1476 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 6 to 163 (158 residues), 83.6 bits, see alignment E=6.3e-28 PF04542: Sigma70_r2" amino acids 11 to 73 (63 residues), 53.2 bits, see alignment E=3.1e-18 PF08281: Sigma70_r4_2" amino acids 110 to 158 (49 residues), 56.1 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 70% identity to sli:Slin_5961)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ9 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Echvi_1476 RNA polymerase sigma factor, sigma-70 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTLEFSYSINEHSKSLKPFALRLTKDVDDANDLLQETMLKAYTNRDKFSDGTNLRAWLY
TIMKNTFFTRYQRMVRRATFVDSTDNLHYINSGDVSIENRAHSKFAMDDINYCINHLNAD
YRTPFMMYFKGFKYQEIADDLNLPIGTVKNRIHLARKILKDNLKIYKTN