Protein Info for Echvi_1473 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 7 to 119 (113 residues), 129 bits, E=2.2e-41
• PF02770: Acyl-CoA_dh_M
  • amino acids 124 to 218 (95 residues), 89 bits, E=3.7e-29
• PF00441: Acyl-CoA_dh_1
  • amino acids 230 to 379 (150 residues), 161.8 bits, E=2.8e-51
• PF08028: Acyl-CoA_dh_2
  • amino acids 246 to 362 (117 residues), 80.2 bits, E=3.7e-26

Best Hits

Swiss-Prot: 52% identical to ACDA_BACSU: Acyl-CoA dehydrogenase (acdA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 77% identity to mtt:Ftrac_2408)

MetaCyc: 50% identical to butanoyl-CoA dehydrogenase (NAD+, ferredoxin) monomer (Clostridium kluyveri)
RXN-16834 [EC: 1.3.1.109]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• glycerol degradation to butanol (12/16 steps found)
• pyruvate fermentation to butanol I (6/8 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 4-aminobutanoate degradation V (3/7 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• L-glutamate degradation XI (reductive Stickland reaction) (2/7 steps found)
• succinate fermentation to butanoate (2/7 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• L-lysine fermentation to acetate and butanoate (2/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of L-lysine degradation (9/43 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.1.109 or 1.3.99.2

Sequence Analysis Tools

See L0FV11 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Echvi_1473 Acyl-CoA dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MMNFQLTENQSMIAQMIRDFGAKEITPFRKEWDDHQTFPLPLFKKLGELGLMGVLIPSEY
GGSGFGYLEYVTAILELAKLDPGIGLSMAAHNSLCSGHIMLFGSEEQKQKYLPKLASCEF
LGAWGLTEPNTGSDAANMKTTATAEGDYFVLNGAKNFITHGVSGDVAVVIARTGEVGDKH
GMTAFVVEKGTEGFRGGRKEDKLGMRTSETAELIFEDCRVHKSQILGEVGEGFIQSMKVL
DGGRISIAALSLGIAEGAFEAALSYSKERQQFQKPISAYQGISFKLADMATKLEAAKLLT
FKAADLKNRGEYVTLASAQAKYYASEIAVELANEAVQVYGGYGFTKDYPVEKYYRDVKLC
TIGEGTSEIQKIVISRELLK