Protein Info for Echvi_1472 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): UDP-glucose 4-epimerase (EC 5.1.3.2)
Rationale: Important for utilizing D-Galactose; this is part of the Leloir pathway
Original annotation: UDP-glucose-4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 3 to 335 (333 residues), 417.2 bits, E=1.9e-129
• PF01370: Epimerase
  • amino acids 4 to 256 (253 residues), 152.7 bits, E=3.5e-48
• PF02719: Polysacc_synt_2
  • amino acids 4 to 181 (178 residues), 39.7 bits, E=1e-13
• PF08659: KR
  • amino acids 4 to 84 (81 residues), 33 bits, E=1.7e-11
• PF01073: 3Beta_HSD
  • amino acids 5 to 162 (158 residues), 47 bits, E=5.5e-16
• PF16363: GDP_Man_Dehyd
  • amino acids 5 to 327 (323 residues), 176.1 bits, E=4e-55

Best Hits

Swiss-Prot: 48% identical to UGE2_ARATH: UDP-glucose 4-epimerase 2 (UGE2) from Arabidopsis thaliana

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 62% identity to lby:Lbys_1312)

MetaCyc: 45% identical to UDP-glucose 4-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• stachyose degradation (4/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (3/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See L0FXG3 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Echvi_1472 UDP-glucose 4-epimerase (EC 5.1.3.2) (Echinicola vietnamensis KMM 6221, DSM 17526)
MQQILITGGAGYIGSHTAVALVNAGYEPIIVDNFSNSNKEVLNGLEKILGAPVKYHEGDC
NDRKFMQAVFEENDLQGVIHFAASKAVGESTKIPLTYYSNNINSLIILLETMKQFGVKDI
VFSSSCTVYGQPDKLPVKETTPRKDAESPYGNTKKICEDILTDHVKSGAPARVVALRYFN
PIGAHPSSLIGELPLGVPANLIPFVTQTGAGIREKITVFGDDYNTPDGTCIRDYIHVMDL
ADAHVKSIQYLADQPENFIDLFNVGTGNGNTVMEVIKAFEKVSEKPLNYEIGPRRSGDIE
KVWANTDKVSKVLGWTPQFGLEEALRDAWNWQLSLKK