Protein Info for Echvi_1470 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00551: Formyl_trans_N
  • amino acids 2 to 181 (180 residues), 155.8 bits, E=5.4e-50
• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 2 to 184 (183 residues), 158.3 bits, E=8.6e-51

Best Hits

Swiss-Prot: 39% identical to PUR3_HAEIN: Phosphoribosylglycinamide formyltransferase (purN) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 54% identity to fjo:Fjoh_1136)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

See L0FY98 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Echvi_1470 phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKIAILASGNGSNAEEIIKHFNGSTKGKVAIIASNKKDAYVLERAKNHDIPFISFSKKE
MDEGLLEKTFEALEIDLVVLAGFLLKVPDGLIQMFPEKIINIHPALLPKFGGKGMYGMRV
HEAVKEKGEKETGITIHYVNEKYDDGRVIFQESVKVEETDSPDEIAHKVHALEHKYFPKV
IESLL