Protein Info for Echvi_1468 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cell shape determining protein, MreB/Mrl family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 7 to 336 (330 residues), 423.5 bits, see alignment E=2.7e-131 PF06723: MreB_Mbl" amino acids 9 to 335 (327 residues), 421.9 bits, see alignment E=2.8e-130 PF00012: HSP70" amino acids 104 to 200 (97 residues), 37.4 bits, see alignment E=1.9e-13 PF14450: FtsA" amino acids 158 to 317 (160 residues), 44 bits, see alignment E=5.8e-15

Best Hits

Swiss-Prot: 51% identical to MREB_BACSU: Cell shape-determining protein MreB (mreB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 86% identity to mtt:Ftrac_2256)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV07 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Echvi_1468 cell shape determining protein, MreB/Mrl family (Echinicola vietnamensis KMM 6221, DSM 17526)
MGLFDFFSSDIAIDLGTANTLIIHKEKIVVDEPSIIAIDKSSNRILAVGREAMNMHEKTH
ENIKTVRPLKDGVIADFYAAEQMIRGLIKMIPGHKKGMFPQSHRMVICIPSGITEVEKRA
VRDSAEHAGAKEVYMVYEPIAAAIGIGIDIEKPMGSMIVDIGGGTTEIALIALSGIVADQ
SIRVAGDTFTKDILDYMRRQHNLLIGERSAEKVKIAIGSALTELDDAPEDYEIRGRDLMT
GIPKVIKVSYSEIAFALDKSVSKIEEAVLKALEIAPPELSADIYDNGIHLTGGGALLKGL
DRRLHQKTKLPIHIAEDPLRAVVRGTGTALKNINSFRTVLMT