Protein Info for Echvi_1466 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 52 to 85 (34 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 41% identity to mtt:Ftrac_2254)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWP8 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Echvi_1466 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNSRTVIASIGGIFLYFIVQVLILKNLVLFGMAFCFLYVIYLLLLPIEIKTIPLMVIAFV
LGFSIDIFYDSLGIHTASAVMLAFFRKPWITVITPTGGYDSNTPPTLLNMGMGWFLMYSV
PLILLHHLTFFLIDNLGTSLYIPMVYKTLSSTVFTFIIGMIVQVLFYKKRRGI