Protein Info for Echvi_1459 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF11967: RecO_N" amino acids 1 to 79 (79 residues), 77.9 bits, see alignment E=5e-26 TIGR00613: DNA repair protein RecO" amino acids 4 to 151 (148 residues), 69.4 bits, see alignment E=1.5e-23 PF02565: RecO_C" amino acids 86 to 213 (128 residues), 37.5 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 46% identity to sli:Slin_1197)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYK9 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Echvi_1459 DNA repair protein RecO (Echinicola vietnamensis KMM 6221, DSM 17526)
MLKKTQGIVIHYIKYRESSIIVKIFTRDLGLKSYIVNGVRSAKSKSKMALYQPLSLLDLV
VYDKENASLNRISEVKLNYPFQRIPFDFHRSGVAMFVGEVLSKAIYENYQNEYLFDFIYQ
SVTFLDSETVGLSTYPLSFLLETSRFLGFAPDTAGEFFEQIHPDINSPAFAQEEKKYFAE
LLKSPFDPGIKVPAAIRKRLLDELLTFYKLHLDTFFEVRSLEVLRNLR