Protein Info for Echvi_1456 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: chromate transporter, chromate ion transporter (CHR) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 145 to 172 (28 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 296 to 322 (27 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 360 to 377 (18 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF02417: Chromate_transp" amino acids 15 to 174 (160 residues), 106.5 bits, see alignment E=7.6e-35 amino acids 222 to 394 (173 residues), 126.1 bits, see alignment E=7.2e-41 TIGR00937: chromate efflux transporter" amino acids 17 to 393 (377 residues), 187.5 bits, see alignment E=2.8e-59

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 55% identity to sli:Slin_1603)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWN8 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Echvi_1456 chromate transporter, chromate ion transporter (CHR) family (Echinicola vietnamensis KMM 6221, DSM 17526)
MTIRKVKYYLYLKDVITLSVTAFGGPQAFLAMVLDIMVKKRRYITEEELWELHALCQVLP
GPTSTQTISAIGYRVGGPNLAYLSLLVWILPATIIMTAAAILVDFLQTQTKGSLNFAKFI
QPMAIGFIIYAAQKTIGKMVKTTEAMVLMLLSAFVAFFYNSPYIFPFMLVAGGITTSLKF
NKQPKIEEKSGIKIQWANFLLWGGVLIMAATLGHFTKILPIRLFENFYRNGSLIFGGGQV
LVPYLYTEFVEFKAYLTSEEFLTGYAISQGVPGPTFSISSYIGALSMRSAGLGTGGAIIG
GLVSAAGIFLPGTFLIFFVIRFWDELKKYRPVRAALEGINAVSCGMLIAAAYLLFEPMPA
NFFNIAAIAFTYFLLQFTKIPSPLIIIGGIVVGLGYQLVIHNFLG