Protein Info for Echvi_1450 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to KMO_DANRE: Kynurenine 3-monooxygenase (kmo) from Danio rerio

KEGG orthology group: K00486, kynurenine 3-monooxygenase [EC: 1.14.13.9] (inferred from 51% identity to mtt:Ftrac_2836)

Predicted SEED Role

"Kynurenine 3-monooxygenase (EC 1.14.13.9)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.14.13.9)

MetaCyc Pathways

NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (4/5 steps found)
3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
L-tryptophan degradation III (eukaryotic) (7/15 steps found)
L-tryptophan degradation IX (4/12 steps found)
L-tryptophan degradation XI (mammalian, via kynurenine) (8/23 steps found)

KEGG Metabolic Maps

Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY82 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Echvi_1450 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKNDVSIIGAGLIGSLLGIYLQKRGLDVSIYEKRPDLRDKKYAPAGRSINMALSDRGWK
ALDKIGLREMVAPYVIPMYGRRVHDEHGETSFLPYGKENQAIYSISRGKFNHMLVDEAER
YGAKMNFNHSCEEISIADTAIKVVLPDGTQEYRETDVIIGADGAYSSLRDAMQRQTRLNY
KQEYISHGYKELTIPPTAEGEFAMDPNALHIWPRGQFMLIALPNPDKSFTCTLFLPFEGG
KVCFDKINDEEDLESVFKTYFADAFALMPDLNKEYFGNPTSSLINVECFPWLANKSMLIG
DACHAMVPFFGQGMNCGFEDCFILDGLIEKYGTTSWELVFEKFQKVRKPDTDAISEMARN
NFTEMRDSVANPRFLVRKKIEAKLHELYPTEWIPLYTMVTFSDMKYADAYAQGKLQDEVM
DKVMEDPMIMQNWQQVDYGAIISQIETARMV