Protein Info for Echvi_1417 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fibrobacter succinogenes major domain (Fib_succ_major).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02145: fibrobacter succinogenes major paralogous domain" amino acids 248 to 466 (219 residues), 50.1 bits, see alignment E=2.6e-17 PF09603: Fib_succ_major" amino acids 255 to 465 (211 residues), 134.2 bits, see alignment E=3.4e-43

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUV9 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Echvi_1417 Fibrobacter succinogenes major domain (Fib_succ_major). (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKTSYLLLIFLLALSGCMQEASDEAPQLGIVNLSSITFEDMEHYAPNHRSTSLSAWQHI
LPEEAEITFTDKATGQEYHLTYNPYDLLSGATIVLPYGQYSYYTKVWGAEEAKYLPYKLS
GEFELNRAALDITVKATTKFGLITLDATHVQEAYLDHGKALQLTENGKYYYLYVRKGSNR
TLSVVENFSHQMLQQTITLKGFHHYHYKLDLEKEETGLQLIKLNLGEFHFDFSDVNIDGE
GQTVTDAEGNVYPVVKIGDQYWLGENLRSATYCNGERIPQHPLPMKWEDNEDGAYVLTRQ
DAERQVTNFYYPTSVASSENNICPCNWHVSTDEDWKILERYLGIAESELESNSHLRGIAA
ELADKIMANDWLDYYPPYLTGITITNASRFSAYPTGGVDFDYESDYYFGVNTDDVSIWYS
LDEASSANPMLSRAISPTGNGVYDGSGILRGRSGYGSHLPIRCVKD