Protein Info for Echvi_1414 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF00665: rve" amino acids 89 to 185 (97 residues), 79.3 bits, see alignment E=2.4e-26 PF13683: rve_3" amino acids 174 to 239 (66 residues), 80.5 bits, see alignment E=6.2e-27

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 52% identity to dba:Dbac_1236)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY51 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Echvi_1414 Transposase and inactivated derivatives (Echinicola vietnamensis KMM 6221, DSM 17526)
MLFHMSTSVYYYRPRRRDDSEIIEQLSGLAELYKTWGFWLMYKRLRKLHYMWNHKRVYRV
YTSMRLNLRNKRKKRLPVRVKAPLLCPLGPNITWSLDFMHDTLACGRKIRTLNIIDDFSR
EALGIVVDSGLPARRVIRELEMLVSWRGKPEKIRSDNGPEFISAAMEEWCVENSIEWEFT
QPGKPTQNSLVEHFNRTFRHDVLDRDMFDSVAELRTYANAWAWMYNNVRPHSALGYLTPT
EFLLKYGKLCEFPTLQQDNNNKWDWNSLVLGVAS